WDR18 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2089801
Artikelname: WDR18 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2089801
Hersteller Artikelnummer: orb2089801
Alternativnummer: BYT-ORB2089801-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human WDR18
Konjugation: Biotin
Alternative Synonym: Ipi3, R32184_1
WDR18 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 48kDa
NCBI: 077005
UniProt: Q9BV38
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: PMWSCIVWELHSGANLLTYRGGQAGPRGLALLNGEYLLAAQLGKNYISAW