Tns3 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer:
BYT-ORB2089813
| Artikelname: |
Tns3 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage |
| Artikelnummer: |
BYT-ORB2089813 |
| Hersteller Artikelnummer: |
orb2089813 |
| Alternativnummer: |
BYT-ORB2089813-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the C-terminal region of MOUSE Tns3 |
| Konjugation: |
Biotin |
| Alternative Synonym: |
Ten, TEM6, Tens1, BC023928, F830010I22Rik |
| Tns3 Rabbit Polyclonal Antibody (Biotin) |
| Klonalität: |
Polyclonal |
| Molekulargewicht: |
60kDa |
| UniProt: |
Q5SSZ5 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequenz: |
Synthetic peptide located within the following region: FLTVSPGASSHHSPGLQNQNVSLPGQPPLPEKKRASEGDRSLGSVSPSSS |
