SUCLG2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2089828
Artikelname: SUCLG2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2089828
Hersteller Artikelnummer: orb2089828
Alternativnummer: BYT-ORB2089828-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human SUCLG2
Konjugation: Biotin
Alternative Synonym: G-SCS, GBETA, GTPSCS
SUCLG2 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 48kDa
NCBI: 001171070
UniProt: Q96I99
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: AKINFDDNAEFRQKDIFAMDDKSENEPIENEAAKYDLKYIGLDGNIACFV