CENPK Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2090299
Artikelname: CENPK Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2090299
Hersteller Artikelnummer: orb2090299
Alternativnummer: BYT-ORB2090299-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of human CENPK
Konjugation: Biotin
Alternative Synonym: P33, Solt, CENP-K, FKSG14, AF5alpha
CENPK Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 26kDa
NCBI: 011541839
UniProt: D6RHD3
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: EMVLSTKESKNEKLKEDLEREQRWLDEQQQIMESLNVLHSELKNKVETFS