ANO5 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2090323
Artikelname: ANO5 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2090323
Hersteller Artikelnummer: orb2090323
Alternativnummer: BYT-ORB2090323-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Immunogen: The immunogen is a synthetic peptide directed towards the following sequence IEDGKKRFGIERLLNSNTYSSAYPLHDGQYWKPSEPPNPTNERYTLHQNW
Konjugation: Biotin
Alternative Synonym: GDD1, LGMD2L, LGMDR12, TMEM16E
ANO5 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 107 kDa
NCBI: 998764
UniProt: Q75V66
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: IEDGKKRFGIERLLNSNTYSSAYPLHDGQYWKPSEPPNPTNERYTLHQNW