ADPRHL2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2090332
Artikelname: ADPRHL2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2090332
Hersteller Artikelnummer: orb2090332
Alternativnummer: BYT-ORB2090332-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human ADPRHL2
Konjugation: Biotin
Alternative Synonym: ARH3, ADPRHL2, CONDSIAS
ADPRHL2 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 39kDa
NCBI: 060295
UniProt: Q9NX46
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: SVLDARELGMEERPYSSRLKKIGELLDQASVTREEVVSELGNGIAAFESV