TRAPPC3 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2090347
Artikelname: TRAPPC3 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2090347
Hersteller Artikelnummer: orb2090347
Alternativnummer: BYT-ORB2090347-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human TRAPPC3
Konjugation: Biotin
Alternative Synonym: BET3
TRAPPC3 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 20kDa
NCBI: 055223
UniProt: O43617
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: TQLCKDYENDEDVNKQLDKMGFNIGVRLIEDFLARSNVGRCHDFRETADV