MTX3 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Artikelnummer: BYT-ORB2090874
Artikelname: MTX3 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Artikelnummer: BYT-ORB2090874
Hersteller Artikelnummer: orb2090874
Alternativnummer: BYT-ORB2090874-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human MTX3
Konjugation: FITC
Alternative Synonym: DKFZp686O1788
MTX3 Rabbit Polyclonal Antibody (FITC)
Klonalität: Polyclonal
Molekulargewicht: 35kDa
NCBI: 95840
UniProt: Q5HYI7
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: NRNQQQIDFGISPAGQETVDANLQKLTQLVNKESNLIEKMDDNLRQSPQL