MTX3 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Artikelnummer: BYT-ORB2090876
Artikelname: MTX3 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Artikelnummer: BYT-ORB2090876
Hersteller Artikelnummer: orb2090876
Alternativnummer: BYT-ORB2090876-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human MTX3
Konjugation: HRP
Alternative Synonym: DKFZp686O1788
MTX3 Rabbit Polyclonal Antibody (HRP)
Klonalität: Polyclonal
Molekulargewicht: 27kDa
NCBI: 001161213
UniProt: E9PB57
Puffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Formulierung: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequenz: Synthetic peptide located within the following region: VSQPAKILNFLRKQKYNADYELSAKQGADTLAYIALLEEKLLPAVLHTFW