MTX3 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2090878
Artikelname: MTX3 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2090878
Hersteller Artikelnummer: orb2090878
Alternativnummer: BYT-ORB2090878-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human MTX3
Konjugation: Biotin
Alternative Synonym: DKFZp686O1788
MTX3 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 27kDa
NCBI: 001161213
UniProt: E9PB57
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: VSQPAKILNFLRKQKYNADYELSAKQGADTLAYIALLEEKLLPAVLHTFW