KIR2DL3 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Artikelnummer: BYT-ORB2090891
Artikelname: KIR2DL3 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Artikelnummer: BYT-ORB2090891
Hersteller Artikelnummer: orb2090891
Alternativnummer: BYT-ORB2090891-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human KIR2DL3
Konjugation: HRP
Alternative Synonym: p58, NKAT, GL183, NKAT2, CD158b, KIR2DL, NKAT2A, NKAT2B, CD158B2, KIR-K7b, KIR-K7c, KIR2DS5, KIRCL23, KIR-023GB
KIR2DL3 Rabbit Polyclonal Antibody (HRP)
Klonalität: Polyclonal
Molekulargewicht: 26kDa
UniProt: P43628
Puffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Formulierung: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequenz: Synthetic peptide located within the following region: GTSVVIILFILLLFFLLHRWCCNKKNAVVMDQEPAGNRTVNREDSDEQDP