KIR2DL3 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Artikelnummer:
BYT-ORB2090891
| Artikelname: |
KIR2DL3 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage |
| Artikelnummer: |
BYT-ORB2090891 |
| Hersteller Artikelnummer: |
orb2090891 |
| Alternativnummer: |
BYT-ORB2090891-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the middle region of Human KIR2DL3 |
| Konjugation: |
HRP |
| Alternative Synonym: |
p58, NKAT, GL183, NKAT2, CD158b, KIR2DL, NKAT2A, NKAT2B, CD158B2, KIR-K7b, KIR-K7c, KIR2DS5, KIRCL23, KIR-023GB |
| KIR2DL3 Rabbit Polyclonal Antibody (HRP) |
| Klonalität: |
Polyclonal |
| Molekulargewicht: |
26kDa |
| UniProt: |
P43628 |
| Puffer: |
Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6. |
| Formulierung: |
Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6. |
| Sequenz: |
Synthetic peptide located within the following region: GTSVVIILFILLLFFLLHRWCCNKKNAVVMDQEPAGNRTVNREDSDEQDP |