KIR2DL3 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer:
BYT-ORB2090893
| Artikelname: |
KIR2DL3 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage |
| Artikelnummer: |
BYT-ORB2090893 |
| Hersteller Artikelnummer: |
orb2090893 |
| Alternativnummer: |
BYT-ORB2090893-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the middle region of Human KIR2DL3 |
| Konjugation: |
Biotin |
| Alternative Synonym: |
p58, NKAT, GL183, NKAT2, CD158b, KIR2DL, NKAT2A, NKAT2B, CD158B2, KIR-K7b, KIR-K7c, KIR2DS5, KIRCL23, KIR-023GB |
| KIR2DL3 Rabbit Polyclonal Antibody (Biotin) |
| Klonalität: |
Polyclonal |
| Molekulargewicht: |
26kDa |
| UniProt: |
P43628 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequenz: |
Synthetic peptide located within the following region: GTSVVIILFILLLFFLLHRWCCNKKNAVVMDQEPAGNRTVNREDSDEQDP |