KIR2DL5B Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Artikelnummer: BYT-ORB2090895
Artikelname: KIR2DL5B Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Artikelnummer: BYT-ORB2090895
Hersteller Artikelnummer: orb2090895
Alternativnummer: BYT-ORB2090895-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human KIR2DL5B
Konjugation: FITC
Alternative Synonym: KIR2DL5, KIR2DLX, KIR2DL5.2
KIR2DL5B Rabbit Polyclonal Antibody (FITC)
Klonalität: Polyclonal
Molekulargewicht: 38kDa
NCBI: 001018091
UniProt: Q8NHK4
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: DQDPQEVTYAQLDHCVFTQTKITSPSQRPKAPPTDTTMYMELPNAKPRSL