CR1L Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Artikelnummer: BYT-ORB2090918
Artikelname: CR1L Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Artikelnummer: BYT-ORB2090918
Hersteller Artikelnummer: orb2090918
Alternativnummer: BYT-ORB2090918-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human CR1L
Konjugation: HRP
Alternative Synonym: MGC129536
CR1L Rabbit Polyclonal Antibody (HRP)
Klonalität: Polyclonal
Molekulargewicht: 59kDa
NCBI: 783641
UniProt: Q2VPA4
Puffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Formulierung: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequenz: Synthetic peptide located within the following region: IGTYLNYECRPGYSGRPFSIICLKNSVWTSAKDKCKRKSCRNPPDPVNGM