CR1L Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Artikelnummer: BYT-ORB2090922
Artikelname: CR1L Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Artikelnummer: BYT-ORB2090922
Hersteller Artikelnummer: orb2090922
Alternativnummer: BYT-ORB2090922-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human CR1L
Konjugation: FITC
Alternative Synonym: MGC129536
CR1L Rabbit Polyclonal Antibody (FITC)
Klonalität: Polyclonal
Molekulargewicht: 59kDa
NCBI: 783641
UniProt: Q2VPA4
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: ALNKWEPELPSCSRVCQPPPDVLHAERTQRDKDNFSPGQEVFYSCEPGYD