Chmp5 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2090926
Artikelname: Chmp5 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2090926
Hersteller Artikelnummer: orb2090926
Alternativnummer: BYT-ORB2090926-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Chmp5
Konjugation: Biotin
Alternative Synonym: AW545668, 2210412K09Rik
Chmp5 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 24kDa
NCBI: 084090
UniProt: Q9D7S9
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: LDALGDELLADEDSSYLDEAASAPAIPEGVPTDTKNKDGVLVDEFGLPQI