SLC13A1 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Artikelnummer: BYT-ORB2090945
Artikelname: SLC13A1 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Artikelnummer: BYT-ORB2090945
Hersteller Artikelnummer: orb2090945
Alternativnummer: BYT-ORB2090945-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human SLC13A1
Konjugation: HRP
Alternative Synonym: NAS1, NaSi-1
SLC13A1 Rabbit Polyclonal Antibody (HRP)
Klonalität: Polyclonal
Molekulargewicht: 66kDa
NCBI: 071889
UniProt: Q9BZW2
Puffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Formulierung: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequenz: Synthetic peptide located within the following region: MTYFNGSTNHGLEIDESVNGHEINERKEKTKPVPGYNNDTGKISSKVELE