SLC13A1 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Artikelnummer: BYT-ORB2090946
Artikelname: SLC13A1 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Artikelnummer: BYT-ORB2090946
Hersteller Artikelnummer: orb2090946
Alternativnummer: BYT-ORB2090946-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human SLC13A1
Konjugation: FITC
Alternative Synonym: NAS1, NaSi-1
SLC13A1 Rabbit Polyclonal Antibody (FITC)
Klonalität: Polyclonal
Molekulargewicht: 66kDa
NCBI: 071889
UniProt: Q9BZW2
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: MTYFNGSTNHGLEIDESVNGHEINERKEKTKPVPGYNNDTGKISSKVELE