SLC13A1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2090947
Artikelname: SLC13A1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2090947
Hersteller Artikelnummer: orb2090947
Alternativnummer: BYT-ORB2090947-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human SLC13A1
Konjugation: Biotin
Alternative Synonym: NAS1, NaSi-1
SLC13A1 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 66kDa
NCBI: 071889
UniProt: Q9BZW2
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: MTYFNGSTNHGLEIDESVNGHEINERKEKTKPVPGYNNDTGKISSKVELE