PPP1CB Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2090962
Artikelname: PPP1CB Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2090962
Hersteller Artikelnummer: orb2090962
Alternativnummer: BYT-ORB2090962-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human PPP1CB
Konjugation: Biotin
Alternative Synonym: MP, PP1B, PP1c, NSLH2, PP-1B, PPP1CD, PP1beta, PPP1beta, HEL-S-80p
PPP1CB Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 37kDa
NCBI: 002700
UniProt: P62140
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: LFSAPNYCGEFDNAGGMMSVDETLMCSFQILKPSEKKAKYQYGGLNSGRP