Mrpl12 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2090983
Artikelname: Mrpl12 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2090983
Hersteller Artikelnummer: orb2090983
Alternativnummer: BYT-ORB2090983-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Rat Mrpl12
Konjugation: Biotin
Alternative Synonym: Rpm12
Mrpl12 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 29kDa
NCBI: 001025071
UniProt: D3ZXF9
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: RRSEALAGAPLDNAPKEYPPKIQQLVQDIASLTLLEISDLNELLKKTLKI