MMP21 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2091508
Artikelname: MMP21 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2091508
Hersteller Artikelnummer: orb2091508
Alternativnummer: BYT-ORB2091508-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of mouse MMP21
Konjugation: Biotin
Alternative Synonym: HTX7, MMP-21
MMP21 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 50kDa
NCBI: 671724
UniProt: Q8N119
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: GEVRVR target=_blank>YIPQEPAFELDWADRKAIQRLYGSCKGSFDTVFDWIRKERNQYGEVRVR