BRS3 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2091574
Artikelname: BRS3 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2091574
Hersteller Artikelnummer: orb2091574
Alternativnummer: BYT-ORB2091574-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human BRS3
Konjugation: Biotin
Alternative Synonym: BB3, BB3R, BBR3
BRS3 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 44 kDa
NCBI: 001718
UniProt: P32247
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: TESSSSVVSNDNTNKGWSGDNSPGIEALCAIYITYAVIISVGILGNAILI