RAET1E Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer:
BYT-ORB2091610
| Artikelname: |
RAET1E Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage |
| Artikelnummer: |
BYT-ORB2091610 |
| Hersteller Artikelnummer: |
orb2091610 |
| Alternativnummer: |
BYT-ORB2091610-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the C-terminal region of Human RAET1E |
| Konjugation: |
Biotin |
| Alternative Synonym: |
RL-4, LETAL, ULBP4, N2DL-4, NKG2DL4, RAET1E2, bA350J20.7 |
| RAET1E Rabbit Polyclonal Antibody (Biotin) |
| Klonalität: |
Polyclonal |
| Molekulargewicht: |
27kDa |
| NCBI: |
631904 |
| UniProt: |
Q8TD07 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequenz: |
Synthetic peptide located within the following region: LEKYFRKLSKGDCDHWLREFLGHWEAMPEPTVSPVNASDIHWSSSSLPDR |