LGI4 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2091619
Artikelname: LGI4 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2091619
Hersteller Artikelnummer: orb2091619
Alternativnummer: BYT-ORB2091619-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human LGI4
Konjugation: Biotin
Alternative Synonym: AMC1, LGIL3, AMCNMY
LGI4 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 57kDa
NCBI: 644813
UniProt: Q8N135
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: LWLEGQPCFVVADASKAGSTTLLCRDGPGFYPHQSLHAWHRDTDAEALEL