CD300C Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer:
BYT-ORB2091652
| Artikelname: |
CD300C Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage |
| Artikelnummer: |
BYT-ORB2091652 |
| Hersteller Artikelnummer: |
orb2091652 |
| Alternativnummer: |
BYT-ORB2091652-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the C-terminal region of Human CD300C |
| Konjugation: |
Biotin |
| Alternative Synonym: |
LIR, CLM-6, CMRF35, IGSF16, CMRF-35, CMRF35A, CMRF-35A, CMRF35A1, CMRF35-A1 |
| CD300C Rabbit Polyclonal Antibody (Biotin) |
| Klonalität: |
Polyclonal |
| Molekulargewicht: |
23kDa |
| NCBI: |
006669 |
| UniProt: |
Q08708 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequenz: |
Synthetic peptide located within the following region: MGTSGPPTKLPVHTWPSVTRKDSPEPSPHPGSLFSNVRFLLLVLLELPLL |
