CTDSP1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2091808
Artikelname: CTDSP1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2091808
Hersteller Artikelnummer: orb2091808
Alternativnummer: BYT-ORB2091808-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human CTDSP1
Konjugation: Biotin
Alternative Synonym: NIF3, SCP1, NLIIF, NLI-IF
CTDSP1 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 29kDa
NCBI: 067021
UniProt: Q9GZU7
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: KQTPVQYLLPEAKAQDSDKICVVIDLDETLVHSSFKPVNNADFIIPVEID