PTH2R Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2091934
Artikelname: PTH2R Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2091934
Hersteller Artikelnummer: orb2091934
Alternativnummer: BYT-ORB2091934-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human PTH2R
Konjugation: Biotin
Alternative Synonym: PTHR2
PTH2R Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 60kDa
NCBI: 005039
UniProt: P49190
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: NSEQDCLPHSFHEETKEDSGRQGDDILMEKPSRPMESNPDTEGCQGETED