BFSP2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2091952
Artikelname: BFSP2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2091952
Hersteller Artikelnummer: orb2091952
Alternativnummer: BYT-ORB2091952-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human BFSP2
Konjugation: Biotin
Alternative Synonym: CP47, CP49, LIFL-L, CTRCT12, PHAKOSIN
BFSP2 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 46kDa
NCBI: 003562
UniProt: Q13515
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: CQQVGEAVLENARLMLQTETIQAGADDFKERYENEQPFRKAAEEEINSLY