ATL1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer:
BYT-ORB2091958
| Artikelname: |
ATL1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage |
| Artikelnummer: |
BYT-ORB2091958 |
| Hersteller Artikelnummer: |
orb2091958 |
| Alternativnummer: |
BYT-ORB2091958-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the C-terminal region of human ATL1 |
| Konjugation: |
Biotin |
| Alternative Synonym: |
FSP1, GBP3, SPG3, HSN1D, SPG3A, AD-FSP, atlastin1 |
| ATL1 Rabbit Polyclonal Antibody (Biotin) |
| Klonalität: |
Polyclonal |
| Molekulargewicht: |
52kDa |
| NCBI: |
001121185 |
| UniProt: |
Q8WXF7 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequenz: |
Synthetic peptide located within the following region: DQVAAALWDQGSTNEALYKLYSAAATHRHLYHQAFPTPKSESTEQSEKKK |
