SPRN Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2091994
Artikelname: SPRN Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2091994
Hersteller Artikelnummer: orb2091994
Alternativnummer: BYT-ORB2091994-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human SPRN
Konjugation: Biotin
Alternative Synonym: SHO, SHADOO, bA108K14.1
SPRN Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 10kDa
NCBI: 001012526
UniProt: Q5BIV9
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: LLAAAFLCDSGAAKGGRGGARGSARGGVRGGARGASRVRVRPAQRYGAPG