STRN Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2092117
Artikelname: STRN Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2092117
Hersteller Artikelnummer: orb2092117
Alternativnummer: BYT-ORB2092117-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of mouse STRN
Konjugation: Biotin
Alternative Synonym: SG2NA, STRN1, PPP2R6A
STRN Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 33kDa
NCBI: 003153
UniProt: O43815
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: RFEMERAHWEVERAELQARIAFLQGERKGQENLKKDLVRRIKMLEYALKQ