GPR35 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Artikelnummer: BYT-ORB2092239
Artikelname: GPR35 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Artikelnummer: BYT-ORB2092239
Hersteller Artikelnummer: orb2092239
Alternativnummer: BYT-ORB2092239-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human GPR35
Konjugation: FITC
GPR35 Rabbit Polyclonal Antibody (FITC)
Klonalität: Polyclonal
Molekulargewicht: 37kDa
NCBI: 001182310
UniProt: Q9HC97
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: YITSKLSDANCCLDAICYYYMAKEFQEASALAVAPSAKAHKSQDSLCVTL