CACNA2D2 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Artikelnummer: BYT-ORB2092247
Artikelname: CACNA2D2 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Artikelnummer: BYT-ORB2092247
Hersteller Artikelnummer: orb2092247
Alternativnummer: BYT-ORB2092247-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human CACNA2D2
Konjugation: HRP
Alternative Synonym: CASVDD, CACNA2D
CACNA2D2 Rabbit Polyclonal Antibody (HRP)
Klonalität: Polyclonal
Molekulargewicht: 129kDa
NCBI: 006021
Puffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Formulierung: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequenz: Synthetic peptide located within the following region: NCSRLFHAQRLTNTNLLFVVAEKPLCSQCEAGRLLQKETHSDGPEQCELV