AMPD2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2092255
Artikelname: AMPD2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2092255
Hersteller Artikelnummer: orb2092255
Alternativnummer: BYT-ORB2092255-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human AMPD2
Konjugation: Biotin
Alternative Synonym: PCH9, SPG63
AMPD2 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 101kDa
NCBI: 004028
UniProt: Q01433
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: VVRALFIREKYMALSLQSFCPTTRRYLQQLAEKPLETRTYEQGPDTPVSA