ANGPTL1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2092303
Artikelname: ANGPTL1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2092303
Hersteller Artikelnummer: orb2092303
Alternativnummer: BYT-ORB2092303-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human ANGPTL1
Konjugation: Biotin
Alternative Synonym: ANG3, ARP1, AngY, ANGPT3, UNQ162, dJ595C2.2
ANGPTL1 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 54kDa
NCBI: 004664
UniProt: O95841
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: KINQRRYPRATDGKEEAKKCAYTFLVPEQRITGPICVNTKGQDASTIKDM