KRT9 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2092423
Artikelname: KRT9 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2092423
Hersteller Artikelnummer: orb2092423
Alternativnummer: BYT-ORB2092423-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human KRT9
Konjugation: Biotin
Alternative Synonym: K9, CK-9, EPPK
KRT9 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 62kDa
NCBI: 000217
UniProt: P35527
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: EIELQSQLSKKAALEKSLEDTKNRYCGQLQMIQEQISNLEAQITDVRQEI