Oprm1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer:
BYT-ORB2092486
| Artikelname: |
Oprm1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage |
| Artikelnummer: |
BYT-ORB2092486 |
| Hersteller Artikelnummer: |
orb2092486 |
| Alternativnummer: |
BYT-ORB2092486-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the middle region of Mouse Oprm1 |
| Konjugation: |
Biotin |
| Alternative Synonym: |
O, m, MO, mu, mor, Oprm, muOR, MOP-R, MOR-1, M-OR-1, MOR-1O |
| Oprm1 Rabbit Polyclonal Antibody (Biotin) |
| Klonalität: |
Polyclonal |
| Molekulargewicht: |
48kDa |
| NCBI: |
001034741 |
| UniProt: |
P42866 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequenz: |
Synthetic peptide located within the following region: CYGLMILRLKSVRMLSGSKEKDRNLRRITRMVLVVVAVFIVCWTPIHIYV |
