NPB Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2093767
Artikelname: NPB Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2093767
Hersteller Artikelnummer: orb2093767
Alternativnummer: BYT-ORB2093767-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of NPB
Konjugation: Biotin
Alternative Synonym: L7, PPL7, PPNPB
NPB Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 14kDa
NCBI: 683694
UniProt: Q8NG41
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: PPGGAGASPELQLHPRLRSLAVCVQDVAPNLQRCERLPDGRGTYQCKANV