DSG1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2093800
Artikelname: DSG1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2093800
Hersteller Artikelnummer: orb2093800
Alternativnummer: BYT-ORB2093800-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of human DSG1
Konjugation: Biotin
Alternative Synonym: DG1, DSG, CDHF4, EPKHE, PPKS1, SPPK1, EPKHIA
DSG1 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 44kDa
NCBI: 001933
UniProt: B7Z845
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: GGIGLSSLGGTASIGHMRSSSDHHFNQTIGSASPSTARSRITKYSTVQYS