Mrpl22 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer:
BYT-ORB2094427
| Artikelname: |
Mrpl22 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage |
| Artikelnummer: |
BYT-ORB2094427 |
| Hersteller Artikelnummer: |
orb2094427 |
| Alternativnummer: |
BYT-ORB2094427-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Mrpl22 |
| Konjugation: |
Biotin |
| Alternative Synonym: |
Rpm, MRP-, HSPC1, L22mt, Rpml25, HSPC158, MRP-L22, MRP-L25, E030011D16Rik |
| Mrpl22 Rabbit Polyclonal Antibody (Biotin) |
| Klonalität: |
Polyclonal |
| Molekulargewicht: |
24kDa |
| NCBI: |
778166 |
| UniProt: |
Q8BU88 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequenz: |
Synthetic peptide located within the following region: AQIIKEVLLEAQDMAVRDHNVEFRSNLHIAESTSGRGQCLKRIRYHGRGR |
