CRISPLD1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2094532
Artikelname: CRISPLD1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2094532
Hersteller Artikelnummer: orb2094532
Alternativnummer: BYT-ORB2094532-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of human CRISPLD1
Konjugation: Biotin
Alternative Synonym: CRISP10, LCRISP1, CRISP-10
CRISPLD1 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 34kDa
NCBI: 001273707
UniProt: B7Z8V9
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: ENLCYKEGSDRYYPPREEETNEIERQQSQVHDTHVRTRSDDSSRNEVISA