SUGCT Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Artikelnummer: BYT-ORB2094795
Artikelname: SUGCT Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Artikelnummer: BYT-ORB2094795
Hersteller Artikelnummer: orb2094795
Alternativnummer: BYT-ORB2094795-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human C7orf10
Konjugation: FITC
Alternative Synonym: GA3, ORF19, DERP13, C7orf10
SUGCT Rabbit Polyclonal Antibody (FITC)
Klonalität: Polyclonal
Molekulargewicht: 47kDa
NCBI: 079004
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: LSVNRNKKSIAVNIKDPKGVKIIYCSITGYGQTGPISQRAGYDAVASAVS