RPA2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2094817
Artikelname: RPA2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2094817
Hersteller Artikelnummer: orb2094817
Alternativnummer: BYT-ORB2094817-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human RPA2
Konjugation: Biotin
Alternative Synonym: REPA2, RPA32, RP-A p32, RP-A p34
RPA2 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 39kDa
UniProt: P15927
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: SLVAFKIMPLEDMNEFTTHILEVINAHMVLSKANSQPSAGRAPISNPGMS