Ndufa8 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2094907
Artikelname: Ndufa8 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2094907
Hersteller Artikelnummer: orb2094907
Alternativnummer: BYT-ORB2094907-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Mouse Ndufa8
Konjugation: Biotin
Alternative Synonym: CI-19kD, CI-PGIV, AW261656, 0610033L03Rik
Ndufa8 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 20kDa
NCBI: 080979
UniProt: Q9DCJ5
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: KEFMLCRWEEKDPRRCLKEGKLVNGCALNFFRQIKSHCAEPFTEYWTCLD