Cytip Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2094931
Artikelname: Cytip Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2094931
Hersteller Artikelnummer: orb2094931
Alternativnummer: BYT-ORB2094931-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Cytip
Konjugation: Biotin
Alternative Synonym: Cb, Cbp, Cyb, Psc, Cybr, C80816, Pscdbp, AI462064, A130053M09Rik
Cytip Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 40kDa
NCBI: 631939
UniProt: Q91VY6
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: RNRSISVTSSGSFSPLWESNYSSVFGTLPRKSRRGSVRKQILKFIPGLHR