Fuca2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2094937
Artikelname: Fuca2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2094937
Hersteller Artikelnummer: orb2094937
Alternativnummer: BYT-ORB2094937-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Mouse Fuca2
Konjugation: Biotin
Alternative Synonym: 0610025O11Rik, 5530401P20Rik
Fuca2 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 54kDa
NCBI: 080075
UniProt: Q99KR8
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: SKTLPELYELVNRYQPEVLWSDGDGGAPDHYWNSTGFLAWLYNESPVRKT