Eif4b Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Artikelnummer: BYT-ORB2096181
Artikelname: Eif4b Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Artikelnummer: BYT-ORB2096181
Hersteller Artikelnummer: orb2096181
Alternativnummer: BYT-ORB2096181-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Eif4b
Konjugation: FITC
Alternative Synonym: C85189, Eif4a2, AL024095, 2310046H11Rik
Eif4b Rabbit Polyclonal Antibody (FITC)
Klonalität: Polyclonal
Molekulargewicht: 41kDa
NCBI: 07171
UniProt: Q922K6
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: DGGSRDHWKDLDRKDGKKDQDSRSAPEPKKPEENPASKFSSASKYAALSV