HARS Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Artikelnummer: BYT-ORB2096186
Artikelname: HARS Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Artikelnummer: BYT-ORB2096186
Hersteller Artikelnummer: orb2096186
Alternativnummer: BYT-ORB2096186-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human HARS
Konjugation: HRP
Alternative Synonym: HRS, HARS, CMT2W, USH3B
HARS Rabbit Polyclonal Antibody (HRP)
Klonalität: Polyclonal
Molekulargewicht: 56kDa
NCBI: 002100
UniProt: P12081
Puffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Formulierung: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequenz: Synthetic peptide located within the following region: FVLKTPKGTRDYSPRQMAVREKVFDVIIRCFKRHGAEVIDTPVFELKETL