GNB3 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Artikelnummer: BYT-ORB2096189
Artikelname: GNB3 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Artikelnummer: BYT-ORB2096189
Hersteller Artikelnummer: orb2096189
Alternativnummer: BYT-ORB2096189-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human GNB3
Konjugation: HRP
Alternative Synonym: CSNB1H
GNB3 Rabbit Polyclonal Antibody (HRP)
Klonalität: Polyclonal
Molekulargewicht: 37kDa
NCBI: 002066
UniProt: P16520
Puffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Formulierung: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequenz: Synthetic peptide located within the following region: SIICGITSVAFSLSGRLLFAGYDDFNCNVWDSMKSERVGILSGHDNRVSC